PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06358.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 369aa    MW: 41578.2 Da    PI: 7.161
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06358.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.3e-52151431128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s +
  KHN06358.1  15 VPPGFRFHPTEEELLQYYLRKKVSYEKIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIYS-N 111
                 69****************************.9***************964444222455**************************************.9 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  KHN06358.1 112 GKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                 99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-599175IPR003441NAC domain
PROSITE profilePS5100557.31615175IPR003441NAC domain
PfamPF023651.2E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MPENMSISVN GQSQVPPGFR FHPTEEELLQ YYLRKKVSYE KIDLDVIRDV DLNKLEPWDI  60
QEKCKIGTTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NGKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNNTAD TNIVSNVMGD AAQEEGWVVC RIFKKKNHLK  180
TLDSPLASGE DRRSHLFDSC DEGALEQILE QMGRSCKEES SYEGNYRNYG RQRRVIHNAP  240
GGDPNNNNNN MVHPLEVGSG GGGLTNWAAL DRLVASQLNG QTDASRQLAC AFNDPTMYCT  300
SDHHDLHQIP TLRSSSTSAA HTRPSPAPAF INPTTQDFTS EIDLWNFTRS TSSLLASSEP  360
LCHVSNTSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-4991789171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973170.0BT097317.1 Soybean clone JCVI-FLGm-21J14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004514929.10.0PREDICTED: NAC domain-containing protein 43-like
RefseqXP_004514930.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-138NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0B2PFG00.0A0A0B2PFG0_GLYSO; NAC domain-containing protein 43
STRINGGLYMA07G05660.11e-173(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-126NAC family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]